PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI02G22940.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 342aa    MW: 36317.6 Da    PI: 7.0791
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI02G22940.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.61.5e-181562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++q+G g+W++ + + g++R++k+c++rw +yl
  ORUFI02G22940.1 15 KGPWTPEEDQKLLAYIEQHGHGCWRSLPTKAGLRRCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding54.52.7e-1768113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  ORUFI02G22940.1  68 RGKFTLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 113
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-25765IPR009057Homeodomain-like
PROSITE profilePS5129418.7411062IPR017930Myb domain
SuperFamilySSF466893.19E-3012109IPR009057Homeodomain-like
SMARTSM007172.5E-151464IPR001005SANT/Myb domain
PfamPF002491.2E-161562IPR001005SANT/Myb domain
CDDcd001674.26E-121762No hitNo description
PROSITE profilePS5129426.33363117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2666117IPR009057Homeodomain-like
SMARTSM007175.8E-1767115IPR001005SANT/Myb domain
PfamPF002491.8E-1668113IPR001005SANT/Myb domain
CDDcd001673.42E-1270113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MGRSPCCEKE AGLKKGPWTP EEDQKLLAYI EQHGHGCWRS LPTKAGLRRC GKSCRLRWTN  60
YLRPDIKRGK FTLQEEQTII QLHALLGNRW SAIATHLPKR TDNEIKNYWN THLKKRLARM  120
GIDPVTHKPR VDADADVAAG GGAAGGGARS RAAAHLSHTA QWESARLEAE ARLAREAKLR  180
ALASPPPATA ALSGVDSPTS TLSFSESALF GAGSAAPDIH GAARAAAVQA VQSSYGEACQ  240
EHHFGGATAE TSFAGAGTLA GVLLDCSVTG ADQRFAERTE ACSGELQGED DDDKGYWNSI  300
LNMVNSSMSS SSSSLTSEVV TDTEMFLPAT AAAAASATPV EF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28131175108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0061610.0AP006161.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:B1267B06.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624862.10.0PREDICTED: myb-related protein Zm38
TrEMBLA0A0E0G8T10.0A0A0E0G8T1_ORYNI; Uncharacterized protein
TrEMBLA0A0E0NGV90.0A0A0E0NGV9_ORYRU; Uncharacterized protein
TrEMBLA2X6G00.0A2X6G0_ORYSI; Putative uncharacterized protein
TrEMBLQ0E0450.0Q0E045_ORYSJ; Os02g0579300 protein
STRINGLOC_Os02g36890.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA008493-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.22e-86myb domain protein 16